Alignment of sequences of cytochrome b from animals to yeast

Mauro Degli Esposti


This alignment is expanded from that published as Fig. 1 in Degli Esposti et al. (1993) "Mitochondrial cytochrome b: evolution and structure of the protein", Biochim. Biophys. Acta 1143, 243-271. Some protein sequences have been corrected for likely errors as detailed in this paper.
* position conferring resistance to centre i inhibitors 
# position conferring resistance to centre o inhibitors             26/3/93
_ residue conserved in all metazoans so far after corrections 


                1              10        20        30        40        50    
Man             MT-PMRK----INPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHY 
Bear, black     -------------------------------------------VCLVLQILTGLFLAMHY 
Bear, brown     -------------------------------------------VCLILQILTGLFLAMHY 
Cat             MT-NIRK----SHPLIKIINHSFIDLPAPSNISAWWNFGSLLGVCLIIQILTGLFLAMHY 
Canis adustus   -----RK----THPLAALVNNSFIDLPAPSNISAWWNFGSLLGVCLILQMTTGLFLAMHY 
Canis aureus    -----RK----THPLAALVNNSFIDLPAPSNISAWWNFGSLLGVCLILQILTGLFLAMHY 
Fox, red        MN-NTRK----THPLVKIVNNSFIDLPAPSNISAWWNFGPLLGVCLILQIVTGLFLAMHY 
Fox, grey       MT-NIRK----THPLAKIVNSSFIDLPAPSNISAWWNLGSLLGVCLILQIMTGLFLAMHY 
Seal            MT-NIRK----THPLMKIINNSFIDLPTPSNISAWWNFGSLLGICLILQILTGLFLAMHY 
Beef            MT-NIRK----SHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHY 
Sheep           MI-NIRK----THPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHY 
Deer, black tai.MT-NIRK----THPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHY 
Giraffe         MI-NIRK----SHPLMKIVNNALIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHY 
Rat 2           MT-NIRK----SHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQILTGLFLAMHY 
Mouse           MT-NMRK----THPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHY 
Akodont.rodent1 MK-ILRK----NHPLLKIVNHSFIDLPTPPNISSWWNFGSLLGMCLVIQILTGLFLAMHY 
Chroeomys mit   MA-ILRK----NHPLLKIINHSFIDLPTPCNISSWWNFGSLLGICLIIQILTGLFLAMHY 
Chroeomys nucl  -------------------------------------FSSLLGVFLIIQILPG-VLAMHY 
Thomomys        ---------------------------------------------------SGLFLAMHY 
Kangaroo rat 1  ---------------------------------------------------SGLFLAMHY 
Dolphin1        MT-NIRK----THPLMKILNDAFIDLPTPSNISSWWNFGSLLGLCLIMQILTGLFLAMHY 
Camel           MT-NIRK----SHPLLKIMNDAFIDLPAPSNISSWWNFGSLLGVCLIMQILTGLFLAMHY 
Pig             MT-NIRK----SHPLMKIINNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHY 
Rabbit          MT-NIRK----THPLLKIVNHSLIDLPAPSNISAMWNFGSLLGLCLMIQIFTGLFLAMHY 
Horse           ----------------------------PSNISSWWNFGSLLGICLILQILTGLFLAMHY
Zebra           MT-NIRK----SHPLMKIINHSFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHY 
Donkey          ------------HPLIKIINHSFIDLPTPSNISSWWNFGSLLGICLILQILTGLFLAMHY 
Rhinocerus      MT-NIRK----SHPLIKIINHSFIDLPTPSNISAWWNFGSLLGICLILQILTGLFLAMHY 
Elephant        MT-DIRK----SHPLLKIINKSFIDLPTPSNMSTWWNFGSLLGACLITQILTGLFLAMHY 
Thylacinus      -------------------------------------FGSLLGICLVIQILTGLFLAMHY 
Possum          -------------------------------------FGSLLGFCLTIQILTGLFLAMHY 
Phalanger       -------------------------------------FGSLLGFCLTIQILTGLFLAMHY 
Chicken         MAPNIRK----SHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHY 
Turkey          MAPNIRK----WHPLLKTINNSLIDLPTPSNISAWWNFGSLLAVCLITQILTGLLLAMHY 
Guinea-fowl     MAPNIRK----SHPLLKMINNSLIDLPTPSNISAWWNFGSLLAVCFMTQIITGLLLAMHY 
Blue tit        ------------------------------------NFGYFLGICLVTQIVTGLLLAMHY
Blackcap        -------------------------------------FGSLLGLCLIVQITTGLLLAMHY 
Warbler magni.  -------------------------------------FGSLLGICLITQIITGLLLAMHY
Babbler         -------------------------------------FGLLLGICLIVQIVTGLLLAAHY 
Rufous babbler  -------------------------------------SGSLLGICLIVRIITGLFLAAHY 
Corcorax        ---------------------------------------------------TGLLLAMHY 
Thrush          -------------------------------------FGPFLGICLIVQIVTGLLLAAHY 
Bowerbird       -------------------------------------FGSLLGICLVTQIITGLLLATHY 
Sicklebill      -------------------------------------FGSVLGICLMVQIITGLLLATHY 
Magpie          -------------------------------------FGSLLGICLMTQIITGLLLAMHY 
Honeyeater      -------------------------------------FGSLLGICLLTQIITGLLLATHY 
Titmouse        -------------------------------------FGSLLGICLLTQIITGLLLAMHY 
Tapaculo        -------------------------------------FGSLLGICLVTQIITGLLMAMHY 
Canastero       -------------------------------------FGSLLGICLMTQIITGLLMAMHY 
Cotinga         -------------------------------------FGSLLGICLMTQIITGLLLAMHY 
Pitta           -------------------------------------FGSLLGICLLRKILTGFLLATQY 
Flicker         -------------------------------------FGSLLGICLLTQIITGLLLATHY 
Shrike 1        -------------------------------------FGSLLGLCLITQIVTGLLLAMHY
Budgerigar      -------------------------------------FGSLLGICLTTQILTGLLLATHY 
Dove            -------------------------------------FGSLLGICLLTQILTGLLLAAHY 
                1              10        20        30        40        50    
Uta Lizard      ------K----SHPMIKIVNNSFIDLPTPSNISAWWNFGSLLGLCLIIQILTGLFLAMHY 
Teiid lizard    -------------------------------------LGSLLGLSLIVEIRTGLFLAMHY 
Lepi lizard     -------------------------------------FGSILGMCLVIQILTGLFLSMHY 
Xantusia lizard -------------------------------------FGSILGLCLLAQIFTGLFLAMHY 
Toad, african   MAPNIRK----SHPLIKIINNSFIDLPTPSNISSLWNFGSLLGVCLIAQIITGLFLAMHY 
Axolotl         ---------------------------------------------------TGLFLAMHY 
Plethodon       -------------------------------------LGSLLGVSLIVQIRTGLFLAMHY
15 J Connecti   -------------------------------------LGSLLGLSLIVQIRTGLFLAMHY 
46 LTT KI       -------------------------------------LGSLLGLSLIVQIRTGLFLAMHY 
21 T Missour2   -------------------------------------PGSLFGLSLIVEIRTGLFLAMHY 
Cod             MA-SLRK----THPILKIANSALVDLPAPSNISVWWNFGSLLGLCLITQLLTGLFLAMHY 
Salmon          -------------------------------------FGSLLGLCLATQSLTGLFLAMHY 
Trout, marmo.   ---------------LKIVNDALVDLPAPSNISVWWNFGSLLGLCLATQILTGLFLAMHY 
Lungfish 1      -----------THPLMKLVNNSFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHF 
Lungfish 2      -------------------------------------FGSLLGLCLIIQILTGLFLAMHF 
Eel             MA-NLRK----THPLLKIANDALVDLPTPSNISAWWNFGSLLGLCLISQILTGLFLAMHY 
Lythrurus       MA-NLRK----THPLMKIANDALVDLPTPSNISAMWNFGSLLGLCLITQILTGLFLAMHY 
Carp            MA-SLRK----THPLIKIANDALVDLPTPSNISAWWNFGSLLGLCLITQILTGLFLAMHY 
Loach           MA-SLRK----THPLIKIANDALVDLPAPSNISVWWNFGSLLGLCLITGILTGLFLAMHY 
Astronotus      ------------------------------------------GLCLSAQILTGLFLAMHY 
Fundulus        MA-NLRK----THPLLKIANDALVDLPAPVNISVWWNFGSLLGLCLIAQILTGLFLAMHY 
Julidochromis   -----RK----PHPLLKIANDALVDLPAPSNISVWWNFGSLLGLCLIAQMDTGLFLAMHY 
Cichlasoma citr.MA-NLRK----THPLLKIANDALVDLPAPSNISVWWNFGSLLGLCLAAQILTGLFLAMHY 
Hemichromis     MA-NLRK----SHPLLKIANDALVDLPTPSNISIWWNFGSLLGLCLIAQILTGLFLAMHY 
Tilapia         MA-NLRK----THPLLKIANDALVDLPAPSNISVWWNFGSLLGLCLAAQILTGLFLAMHY 
Trachurus       MA-NLRK----THPILKIVNDSMIDLPAPSNISAWWNFGSLLALCLITQILTGLFLAMHY 
Bass            MA-ALRK----THPLLKIANHALVDLPAPSNISVWWNFGSLLGLCLISQILTGLFLAMHY 
Mackerel        MA-SLRK----THPLLKIANDALVDLPSPANISVWWNFGSLLGLCLASQILTGLFLAMHY 
Bogue           MA-SLRK----THPLLKIANHALVDLPAPSNISVWWNFGSLLGLCLISQLLTGLFLAMHY 
Sard            MA-SLRK----THPLLKIANDALVDLPTPSNISAWWNFGSLLGLCLISQILTGLFLAMHY 
Tuna            MA-SLRK----THPLLKIANDALVDLPTPSNISAWWNFGSLLGLCLISQILTGLFLAMHY 
Blue marlin     --------------------------------------------------LTGLFLAMHY 
Swordfish       --------------------------------------------------LTGLFLAMHY 
Cottus k        ------------HPLLKIANSALVDLPAPSNISVWWNFGSLLGLSLIIQILTGLFLAMHY 
Mullet, grey    ------K----NHPLFKAANSALIDLPAPASLSSLWNFGSLLGLCLISQIATGLFLAMHY 
Coelacanth      -----------THPLIKIINETIIDLPTPSNISIWWNFGSLLGICLITQIVTGLFLAMHY 
Tarpon          -------------------------------------FGSLLGLCLATQILTGLFLAMHY 
Bichir          -------------------------------------MGSLLGLCLIVQIITGLFLAMHY 
Bowfin          -------------------------------------FGSLLGLCLITQIVTGLFLAMHF 
Spotted gar     -------------------------------------FGSLLGLCLITQTLTGLFLAMHY 
Sturgeon white  MA-NIRK----THPLLKIINGAFIDLPTPSNISVWWNFGSLLGLCLITQILTGLFLAMHY 
Shark 1         MAINIRK----THPLLKIMNHALVDLPAPSNISLWWNFGSLLGLCLIIQILTGLFLVMHY
Isurus shark    MALNIRK----THPLLKIVNHTLIDLPAPSNISVWWNFGSLLGLCLIIQIVTGLFLVMHY
Prickly shark 1 -------------------------------------FGSLLGLCVIIQILTGLFLAMHY 
Prickly shark 2 -------------------------------------FGSLLGLCLIMQTLTGLFLAMHY 
Sea urchin1     MAAPLRK----EHPIFRILNSTFVDLPLPSNLSIWWNSGSLLGLCLVVQILTGIFLAMHY 
Sea urchin2     MLGPLRK----EHPIFRILNSTFVDLPLPSNLSIWWNFGSLLGLCLITQILTGLFLAMHY 
Fly 1           MHKPLRN----SHPLFKIANNALVDLPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHY 
Anopheles       MFKPIRK----THPLIRIANNALVDLPAPSNISAWWNFGSLLGLCLMLQILTGLFLAMHY 
Ant             M-----------NNMLKSLKLELLELPTPINISYLWNMGSILGLFLGVQILSGFMLSMHY
Honeybee        MKK-FMNFF-SSNEFLKMIMSTIY-LPTPVNINYMWNFGSILGIFLMIQIISGFILSMHY 
Shrimp 1        MLGNKMLSLPEQQPTLKIINSALVDLPVPANISIWWNFGSLLGLCLLIQIVIGLFLAMHY 
Krill                                                        VILQILTGLFLAMHY 
Blue mussel 11 .NAPKSVGPWRSTNKLVKIMNDSFYDLPCPVNLNAWWSFGSMLGLCLVIQLLSGLLLSAHY 
Worm, free      ----LKI----NNSLLNFVNGMLVTLPSSKTLTLSWNFGSMLGMVLIFQILTGTFLAFYY 
Worm, round     ----IK---------LDFVNSMVVSLPSSKVLTYGWNFGSMLGMVLGFQILTGTFLAFYY 
                                         ==        =  =  -          =        
Yeast           MA--FRK----SNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHY 
                                       *            *     *    A             


                     60        70        80        90        100       110   
Man             SPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSET--W 
Bear, black     TSDTTTAFSSITHICRDVHYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYLLSET--W 
Bear, brown     TSDTTTAFSSVTHICRDVHYGWVIRYVHANGASMFFICLFMHVGRGLYYGSYLFSET--W 
Canis adustus   TSDTSTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYVFMET--W 
Canis aureus    TSDTATAYSSVTHMCRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYVFMET--W 
Fox, red        TSDTATAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYVFMET--W 
Fox, grey       TSDTATAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFLHVGRGLYLGSYVFMET--W 
Seal            TSDTTTAFSSVTHICRDVNYGWIIRYLHANGASMFFICLYMHVGRGLYYGSYTFTET--W
Beef            TSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLET--W 
Sheep           TPDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYTFLET--W 
Deer, black tai.TSDTMTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYTFLET--W 
Giraffe         TPDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYTFLET--W 
Rat 2           TSDTMTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGLYYGSYTFLET--W 
Mouse           TSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYYGSYTFMET--W 
Akodont. rodent1TSDTTTAFSSVAHICRDVNYGWLIRYLHANGASMFFICLFIHVGRGIYYGSYTLSET--W 
Chroeomys mit   TSDTATAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFIHVGRGIYYGSYMLSET--W 
Chroeomis nucl  TSDTATAFSSVTHICREVN-DWLIRYLHTSGASMFFI------GQAIY-RSSMLSET--W.
Thomomys        TSDSSNSFSSVTHICRDVSYGWLIRYMHANGASLFFICLYIHIGRGIYYGSYLYKET--W 
Kangaroo rat    TPDTLTAFSSVAHICRDVNYGWLIRYMHANGSSLFFICLYLHIGRGIYYGSYSYTET--W 
Dolphin1        TPDTTTAFSSVAHICRDVNYGWFIRYLHANGASMFFICLYAHMGRGLYYGSYMFQET--W 
Camel           TSDTTTAFSSVAHICRDVNYGWIIRYLHANGASMFFICLYIHVGRGLYYGSYTFSET--W 
Pig             TSDTTTAFSSVTHICRDVNYGWVIRYLHANGASMFFICLFIHVGRGLYYGSYMFLET--W 
Rabbit          TSDTTTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLYMHVGRGIYYGSYTYLET--W 
Horse           TSDTT-------HICRDVNYGWIIRt-HAN------------------------------ 
Zebra           TSDTTTAFSSVTHICRDVNYGWIIRYLHANGASMFFICLFIHVGRGLYYGSYTFLET--W 
Donkey          TTDTTTAFSSVTHICRDVNYGWIIRYLHANGASMFFICLFIHVGRGLYYGSYTF------                                                        
Rhinocerus      TPDTTTAFSSVAHICREVNYGWIIRYLHANGASMFFICLFIHMGRGLYYGSYTFLKT--W 
Elephant        TPDTMTAFSSMSHICRDVNYGWIIRQLHSNGASIFFLCLYTHIGRNIYYGSYLYSET--W 
Thylacinus      TSDTSTAFSSVAHICRDVNYGWLIRNLHANGASMFFMCLFLHVGRGIYYGSYLYKET--W
Perameles       TSDTLTAFSSVAHICRDVNYGWLIRNLHANGASMFFMCLFLHVGRGIYYGSYLYKET--W
Possum          TPDTSTAFSSIAHIS--------------------------------------------- 
Phalanger       TPDTSTAFSSIAHIS--------------------------------------------- 
Chicken         TADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGRGLYYGSYLYKET--W 
Turkey          TADTTLAFSSVAYTCRNVQYGWLLHNLHANGASFFFICIFLHIGRGLYYGSYLYKET--W 
Guinea-fowl     TADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Reed bunting    -----LAFSLVAHMCRDVQFGWLIRNLHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Blue tit        TADTSLAFTSVAHTCRNVQFGWLIRNLHANGASFFFICIYFHIGRGIYYGSYLNKET--W 
Blackcap        TADSSLAFASVAHMCRDVQFGWLIRNLHANGASFFFICIYLHIGRGIYYGSYLNKET--W 
Warbler magni.  TADTSLAFSSVAHMCRNVQFGWLIRNLHANGASFFFICIYFHIGRGFCYGSYLNKET--W
Babbler         TADTSLAFASVAHMCRNVQFGWLIRNLHANGASFFFICIYLHIGRGLYYGSYLNKET--W 
Rufous babbler  TADTSLAFNSVAHTCRNVQFGWLIRNLHANGASLFFICIYLHIGRGLYYGSYLNKET--W 
Corcorax        TADTSLAFTSVAHTCRNVQFGWLIRNLHANGASMFFICIYLHIGRGFYYGSYSNKET--W 
Thrush          TADILLAFASVAHMCRNVQFGWLIRNLHANGASFFFICIYLHIGRGLYYGSYLNKET--W 
Bowerbird       TADTNLAFASVAHTCRNVQFGWLIRNLHANGASFFFICIYLHIGRGIYYGSYLNKET--W 
Sicklebill      TADTSLAFSSVAHMCRNVQFGWLIRNLHANGASLFFICIYLHIGRGFYYGSYLNKET--W 
Magpie          TADTTLAFSSVAHMCRNVQFGWLIRNLHANGASFFFICIYLHIGRGFYYGSYLNKET--W 
Honeyeater      TADTSLAFSSVAHMCRDVQFGWLIRNLHANGASFFFICIYIHIGRGLYYGSYLNKET--W 
Titmouse        TADTSLAFTSVAHTCRNVQFGWLIRNLHANGASFFFICIYFHIGRGIYYGSYLNKET--W 
Tapaculo        TADTTLAFTSVAHTCRNVQFGWLIRNLHANGASMFFICIYLHIGRGLYYGSYLFKET--W 
Canastero       TADTTLAFTSVAHTCRNVQFGWLIRNLHANGASMFFICIYLHIGRGFYYGSYLFKET--W 
Cotinga         TADTTLAFTSVAHMCRNVQFGWLIRNLHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Pitta           TADTPLAFSSVAHTCRNVQFGWLIRNLHANGASFFFICIYLHIVRGFYYGSYLNKET--W 
Flicker         TADTTLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIYLHIGRGFYYGSYLFKET--W 
Shrike 1        TADTTLAFSSVAHMCRNVQFGWLIRNLHANGASLFFICIYLHIGRGFYYGSYLNKET--W 
Budgerigar      TADTSLAFSSVANTCRNVQYGWLIRNLHANGASFFFICIYLHIARGFYYGSYLYKET--W 
Dove            TADTTLAFSSVANTCRNVQYGWLIRNLHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Uta Lizard      TADISSAFSSVAHIHRDVQYGWLIRNIHANGASMFFICIY-------------------- 
Teiid Lizard    TADTSLAFSSVANICRDVQYGWLLRTMHANGASMFFICIYLHIGRGLYYGSYFHKEA--W 
Lepi lizard     TADIASAFSSIAHISRDVQYGWLIRNIHANGASIFFISIYLHIARGLYYGSYLYKIT--W 
                     60        70        80        90        100       110  
Xantusia lizard TADITSAFSSVVHICRDVQYGWLIRSIHANGASIFFICLYLHIARGLYYGSYMYMIT--W 
Toad, african   TADTSMAFSSVAHICFDVNYGLLIRNLHANGLSFFFICIYLHIGRGLYYGSFLYKET--W 
Axolotl         TADTSSAFSSVAHICRDVNYGWLMRNIHANGASFFFICIFLHIGRGMYYGSYMFKET--W
Plethodon       TADIYFAFSSVAHICRDLNYGWLIRNIHTNGASLFFICIYMHIGRGIYHGSFMLKET--W 
15 J Connecti   TADTSSAFSSVAHICRDLNYGWLMRNIHANGASFFFICIFLHIARGMYYGSYMFKET--W 
46 LTT KI       TADTSSAFSSVAHICRDLNYGWLMRNIHANGASFFFICIFLHIGRGMYYGSYMFKET--W 
21 T Missour2   TADTSSAFSSVAHICRDLNYGSLMRNIHANGASFFFICIFLHIGRGMYYGSYMFKET--W 
Cod             TSDIETAFSSVVHICRDVNYGWLIRNMHANGASFFFICLYMHIARGLYYGSYLFVET--W 
Salmon          TSDISTAFSSVCHICRDVSYGWLIRNIHANGASFFFICIYMHIARGLYYGSYLYKET--W 
Trout, marm.    TSDISTAFSSVCHICRDVSYGWLIRNIHANGASFFFICIYMHIARGLYYGSYLYKET--W 
Lungfish 1      TADLSMAFSSIAHIMRDVNYGWLLRSIHANGASMFFICLYIHTARGLYYGSYLFKET--W 
Lungfish 2      SADITTAFSSIAHISRDVNYGWLLRNIHANGASMFFICIYIHIARGVYYGSYLYTET--W 
Eel             TSDISTAFSSVAHICRDVNYGWLIRNLHANGASFFFICLYLHIARGLYYGSYLYKET--W 
Lythrurus       TSDISTAFSSVTHICRDVNYGWLIRNMHANGASFFFICIYMHTARGLYYGSYLYKET--W 
Carp            TSDISTAFSSVTHICRDVNYGWLIRNVHANGASFFFICIYMHIARGLYYGSYLYKE--TW 
Loach           TSDISTAFSSVAHICRDVNYGWLIRTIHANGASFFFICLYLHIARGLYYGSYLYKET--W 
Astronotus      TSVIASAFSSVAHTCRDVNYGWLIRNMHANGASF-------------------------- 
Fundulus        TSDISTAFSSVAHICRDVNYGWLIRNMHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Julidochromis   TSDIATAFSSVAHICRDVNYGWLIRNMHANGASFLFICIYLHIGRGLYYGSYLYKET--W 
Cichlasoma citr TSDIATAFSSVAHICRDVNYGWLIRNMHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Hemichromis     TSDITTAFSSVAHICRDVNYGWLIRNMHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Tilapia         TSDIATAFSSIAHICRDVNYGWLIRNMHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Trachurus       TSDIATAFTSVAHICRDVNYGWLIRNMHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Bass            TSDIATAFSSIAHICRDVNYGWLIRNLHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Mackerel        TPDVESAFNSVAHICRDVNFGWLIRNMHANGASFFFICLYLHIGRGLYYGSYLFVET--W 
Bogue           TSDIATAFSSVAHICRDVNYGWLIRNLHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Sard            TPDVESAFASVAHICRDVNFGWLIRNLHANGASFFFICIYFHIGRGLYYGSYLYKET--W 
Tuna            TPDVESAFASVAHICRDVNFGWLIRNLHANGASFFFICIYFHIGRGLYYGSYLYKET--W 
Blue marlin     TSDIATAFTSVAHICRDVNYGWLIRNMHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Swordfish       TSDIATAFTSVAHICRDVNYGWLIRNMHANGASFFFICIYLHIGRGLYYGSYLYKET--W
Cottus k        TSDIATAFSSVGHICRDVNYGWLIRNLHANGASFFFICIYMHIGRGLYYGSYLYKET--W 
Mullet, grey    APETSSAFASVAHICRDVNYGWLIRNMHANGASFFFVCIYIHIGRGLYYGSYLY------ 
Coelacanth      TADITTAFSSVAHICRDVNYGWLIRSTHANGASLFFICIYLHVARGLYYGSYLQKET--W 
Tarpon          TSDISTAFSSVTHICRDVNYGWLIRNIHANGASFFFICIYLHIGRGLYYGSYLYKET--W 
Bichir          VSDISSAFSSVAHICRDVNYGWLIRNFHANGASLFFICIYLHIARGLYYGSYLYKET--W 
Bowfin          TSDISLAFSSVAHICRDVNYGWFLRNIHANGASLFFICLYLHIARGLYYGSYLYKET--W 
Spotted gar     TADITLAFSSVAHICRDVNYGWLLRNIHANGASFFFICIYLHIARGLYYGSYLYKET--W 
Sturgeon, white TADISTAFSSVAHICRDVNYGWLIRNIHANGASFFFICLYLHVARGMYYGSYLQKET--W 
Shark 1         TADISMAFSSVVHICRDVNYGWLIRNIHANGASLFFICVYLHIARGLYYGSYLYKET--W 
Isurus shark    TADISLAFSSVVHICRDVNYGWLIRNIHANGASLFFVCIYFHIARGLYYGSYLYKET--W 
Prickly shark 1 TADISTAFSSVVHICRDVNYGWLIRNIHANGASLFFICVYLHIARGLYYGSYLFKEA--W 
Prickly shark 2 SADISLAFSSVMHICRDVNYGWLIRNIHANGASLFFICIYLHIARGLYYGSFLSKET--W 
Sea urchin1     TADITLAFSSVMHILRDVNYGWFLRYVHANGVSLFFICMYCHIGRGLYYGSYNKIET--W
Sea urchin2     TADISLAFSSASHICRDVNYGWLLRNVHANGASLFFICMYCHIGRGLYYGGSNKIET--W 
Fly             TADVNLAFYSVNHICRDVNYGWLLRTLHANGASFFFICIYLHIGRGIYYGSYLFTPT--W 
Anopheles       AADIETAFNSVNHICRDVNNGWFLRICHANGASFFFACLFMHVGRGVYYESYLYHIT--W 
Ant             CPSTSMAFMSIIHIMQNVNSGWLFHNIHINGATMFFMSMYIHIARGIYFNSFNLTNT--W
Honeybee        CPNIDIAPWSITNIMKDMNSGWLFRLIHANGASFYFLMMYIHISRNLFYCSYKLNNV--W 
Shrimp 1        TASVELAFSSVANICRDVNYGWLLRTVHANGASFFFICIYFHIGRGMYYGSFHYFET--W 
Krill           TSDTTTAFSSVTHICRDVNYGWIIRYLHANGASMFFICLFIHVGRGLYYGSYTSFEN--W 
Blue mussel     TAHEDMAFDSVVHIMRNVEKGWMLRNIHANGSSMFFICIYAHIARGLYYGSYLDKTV--W 
Worm, free      TPDSLMAFSTVQYIMYEVNFGWVFRIFHFNGASLFFIFLYLHIFKGLFFMSYRLKKV--W 
Worm, round     SNDGALAFLSVQYIMYEVNFGWIFRVLHFNGASLFFIFLYLHLFKGLFFMSYRLKKV--W 
                                    =      = ==    =     =                 =
Yeast           SSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLW 
                                                 B   #                      


                     120       130       140       150       160       170   
Man             NIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSP 
Bear, black     NIGIILLFTVMATAFMGYVLPWGQ------------------------------------ 
Bear, brown     NIGIILLFTVMATAFMGYVLPWGQ------------------------------------ 
Canis adustus   NIGVVLLFATMATAFMGYV----------------------------------------- 
Canis aureu     NIGVMLLFATMATAFMGYV----------------------------------------- 
Fox, red        NIGIILLFATMATAFMGYV----------------------------------------- 
Fox, gray       NIGIILLFATMATAFMGYV----------------------------------------- 
Seal            NIGIILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYVGTDLVQWIWGGFSVDKA 
Beef            NIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKA 
Sheep           NIGVILLFATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKA 
Deer, black tai.NIGVILLFTVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKA 
Giraffe         NIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKA 
Rat 2           NIGIILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKA 
Mouse           NIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKA 
Akodont. rodent1NIGIILFLTTMATAFVGYVLP--------------------------------------- 
Chroeomys mit   NIGIVLLLTTMATAFVGYVLP--------------------------------------- 
Chroeomys nucl  NAGVILFLTVMAAAFVGYALP---------------------------------------
Thomomys        NVGILLLFLSMAT----------------------------------------------- 
Kangaroo rat    NIGIILLFLTMAT----------------------------------------------- 
Dolphin1        NIGVLLLLTVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKA 
Dolphin2        ------------------------------------LSAIPTIGTTLVEWIWGGFSVDKG 
Camel           NVGMVLLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKA 
Pig             NIGVVLLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEWIWGGFSVDKA 
Rabbit          NIGIILLFAVMATAFIGYVLPWGQMSLWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKA 
Zebra           NIGIILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKA 
Donkey          ---------------------------WGATVITNLLSAIPYIGTTNVEWIWGGFSVDKA 
Rhinocerus      NIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKA 
Elephant        NTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKA 
Thylacinus      NIGVILLLTVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGTTLAEWVWGGFAVDKA 
Chicken         NTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEWAWGGFSVDNP 
Turkey          NTGVVLLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Guinea-fowl     NTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Reed bunting    NIGIILLLALMATAFVGYVLPWGQMSFWG------------------------------- 
Blue tit        NIGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Blackcap        NVGVLLLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Warbler magni.  NIGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP
Babbler         NIGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Rufous babbler  NIGVILLLALMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Thrush          NMGVILLLTLMATAFVGYALPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Bowerbird       NTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Sicklebill      NIGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Magpie          NIGVILPLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Honeyeater      NVGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Titmouse        NIGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Tapaculo        NTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTIVEWAWGGFSVDNP 
Canastero       NTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Cotinga         NIGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVEWAWGGFSVDNP 
Pitta           NTGVILLLTLMATALVGYVLPWGQMSFWGATVITNLFSAIPYMGQTLVEWAWGGFSGDNP 
Flicker         NTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSALPYIGQTIVEWAWGGFSVDNP
Shrike 1        NVGVILLLTLMATAFVG------------------------------------------- 
Budgerigar      NTGVILLLTLMATAFVGYVLP--------------------------------------- 
Dove            NTGVVLLLTLMATAFVGYVLP--------------------------------------- 
Teiid Lizard    NIGVVLLFLLMATAFMGYILP--------------------------------------- 
Lepi lizard     NTGVILLLLTMATAFVGTMLP--------------------------------------- 
Xantusia lizard NIGVILLFLVMATAFVGYILP--------------------------------------- 
Toad, african   NIGVILLFLVMATAFVGYVLPWGQMSFWGATVITNLLSAVPYIGNVLVQWSLGGFSVDNA 
Axolotl         NIGVILLF----------------------------------------------------
Plethodon       NIGVILFLMTMATAFMGYIFP--------------------------------------- 
                     120       130       140       150       160       170   
15 J Connecti   NIGVILLFLVMATAFVGYILP--------------------------------------- 
46 LTT KI Oh    NIGVILVFLVMATAFVGYILP--------------------------------------- 
21 T Missour2   NIGVILLFLVMATAFVGYMLP--------------------------------------- 
Cod             NIGVVLFLLVMMTSFVGYVLPWGQMSFWGATVITNLMSTVPYVGDALVQWIWGGFSVDNA 
Salmon          NIGVVLLLLTMMTAFVG------------------------------------------- 
Trout marmo.    NIGVVLLLLTMMTAFVGY------------------------------------------ 
Lungfish 1      NIGVILLSLVMVT----------------------------------------------- 
Lungfish 2      NIGVILLLLVMMTAFV-------------------------------------------- 
Eel             NIGVVLILLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGNSLVQWIWGGYSVDNA 
Lythrurus       NIGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYMGDTLVQWIWGGFSVDNA 
Carp            NIGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYMGDMLVQWIWGGFSVDNA 
Loach           NIGVVLFLLVMMTAFVGLVLPWGQMSFWGATVITNLLSAVPYVGDMLVQWIWGGFSVDNA 
Astronotus      ---------------------------------TNLLSAVPYIGNSLVQWIWGGFSVDNA 
Fundulus        NVGVILLLLVMMTAFVGYVLPWGQ------------------------------------ 
Julidochromis   NIGVILLLLTMM------------------------------------------------ 
Cichlasoma citr.NVGVVLLLLTMMTAFVGYVLPWGQMSFWGATVITNLLSAIPYIGNSLVQWLWGGFSVVNA 
Hemichromis     NIGVILLLLTMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYIGNSLVQWIWGGFSVDNA 
Tilapia         NIGVILLLLTMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYIGNSLVQWIWGGFSVDNA 
Trachurus       NTGVVLLLLLMGTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGNTLVQWIWGGFSVDNA 
Bass            NIGVILLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGNTLVQWIWGGFSVDNA 
Mackerel        NVGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGTTLVEWIWGGFSVDNA 
Bogue           NIGVVLLLLVMGTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGGTLVQWIWGGFSVDNA 
Sard            NIGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGTTLVEWIWGGFSVDNA 
Tuna            NIGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGTTLVEWIWGGFSVDNA 
Blue marlin     NVGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGNTLVQWIWGGFSVDNA 
Swordfish       NIGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGNALVQWIWGGFSVDNA 
Cottus k        NIGVILLLLVMMTAFVGYVLP--------------------------------------- 
Coelachant      NIGVILLLLVMMT----------------------------------------------- 
Bichir          NIGVILLLLTMMTAFVG------------------------------------------- 
Bowfin          NVGVVLFLLVMMTAFVG------------------------------------------- 
Spotted gar     NIGVLLLLLVMMTAFV-------------------------------------------- 
Sturgeon, white NIGVILLLLTMMTAFVGYVLPWGQMSFWGATVITNLLSAFPDIGDTLVQWIWGGFSVDNA 
Shark 1         NIGVILLFLLMATAFVGYVLPWGQMSFWGATVITNLLSAFPYIGDMLVQWIWGGFSVDNA 
Isurus shark    NIGVILLFLLMATAFVGYVLPWGQMSFWGATVITNLLSAFPYVGDVLVQWIWGGFSVDNA 
Prickly shark 1 NIGVILLFLLMATAFVGYVLP--------------------------------------- 
Prickly shark 2 NIGVILLFLLMATAFVGYVLP--------------------------------------- 
Sea urchin1     NVGVILFLVTILTAFMGYVLVWGQMSFWAATVITNLVSAIPYIGTIIVQWLWGGFSVDNA 
Sea urchin2     NVGVILFLVTVLTAFVGYVLVWGQMSFWAATVITNLVTAVPYVGTTIVQWLWGGFSVDNA 
Fly 1           LVGVIILFLVMGTAFMGYVLPWGQMSFWGATVITNLLSAIPYLGMDLVQWLWGGFAVDNA 
Anopheles       NTGVIILFLTMATGFLGYVLPWGQMSFWGATVITNLLSAVPYLGIDLVQWIWGGFAVDNT 
Ant             MIGVSIFLVSMATAFLGYVLPWGQMSFWGATVITNLLSTIPYLGNDIVMWVWGGFSINNS 
Honeybee        GIGIMILLMSMAAAFMGYVLPWGQMSYWGATVITNLLSAIPYIGDTIVLWIWGGFSINNA 
Shrimp 1        MTGIALLFLVMAAAFLGYVLPWGQMSFWGATVITNLVSAVPYIGNDVVQWLWGGFAVDNP 
Blue mussel     YFGVHLFLLTMAEAFLGYTLPWGQMSYWGATVITNMLSVSPVVGESMLRYVWGGWTVCNA 
Worm, free      MSGLTIYLLVMMEAFMGYVLVWAQMSFWAAVVITSLLSVIPIWGPTIVTWIWSGFGVTGA 
Worm, round     VSGIVILLLVMMEAFMGYVLVWAQMSFWASVVITSLLSVIPVWGFAIVTWIWSGFTVSSA 
                  =             =    = === =   ===      =  =         =       
Yeast           NVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNP 
                         C#   #   #   #     #   ## 


                     180       190       200       210       220       230   
Man             TLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLL 
Seal            TLTRFFAFHFILPFVVLALAAVHLLFLHETGSNNPSGIMSDSDKIPFHPYYTIKDILGAL 
Beef            TLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGAL 
Sheep           TLTRFFAFHFIFPFIIAALAMVHLLFLHETGSNNPTGIPSDTDKIPFHPYYTIKDILGAI 
Deer, black tai.TLTRFFAFHFILPFIIAALAMVHLLFLHETGSNNPTGIPSDADKIPFHPYYTIKDILGAL 
Giraffe         TLTRFFAFHFILPFIIMALTMVHLLFLHETGSNNPMGIPSDMDKIPFHPYYTIKDILGAL 
Rat 2           TLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDLLGVF 
Mouse           TLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDILGIL 
Dolphin1        TLTRFFAFHFILPFIITALAAVHLLFLHETGSNNPTGIPSNMDMIPFHPYYTIKDILGGL 
Dolphin2        TLTRFFAFHFILPFIITALAAVHLLFLHETGSNNPTGIPSNMDMIPFHPYYTIKDILGAL 
Camel           TLTRFFAFHFILPFIITALVAVHLLFLHETGSNNPTGISSDMDKIPFHPYYTIKDILGAL 
Pig             TLTRFFAFHFILPFIITALAAVHLMFLHETGSNNPTGISSDMDKIPFHPYYTIKDILGAL 
Rabbit          TLTRFFAFHFILPFIIATLVLIHLLFLHETGSNNPTGIPSNSDKIPFHPYYTIKDTLGFL 
Zebra           TLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPSGIPSDMDKIPFHPYYTIKDILGLL 
Donkey          TLTRFFAFHFILPFIITALVIVHLIiLHETGSNdPSGIPSD------------------- 
Rhinocerus      TLTRFFAFHFILPFIISALAITHLLFLHETGSNNPSGIPSNMDKIPFHPYYTIKDILGIL 
Elephant        TLNRFFALHFILPFTMIALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLI 
Thylacinus      TLTRFFAFHFILPSIVTALATVHLLFLHETGSNNPSGINPDSDKIPFHPY---------- 
Chicken         TLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLT 
Turkey          TLTRFFALHFLLPFVIAGITIIHLMFLHESGSNNPLGISSNADKIPFHPYYSIKDILGLT 
Guinea-fowl     TLTRFFALHFLLPFVIAGITIIHLTFLHESGSNNPLGISSNSDKIPFHPYYSIKDILGLT 
Blue tit        TLTRFFALHFLLPFVIAGLTLVHLTFLHETGSNNPLGIPSDCDKIPFHPYYSTKDILGFA 
Blackcap        TLTRFFALHFLLPFVIAGLTLVHLTLLHETGSNNPLGIPSDCDKIPFHPYYSTKDVLGFA 
Warbler magni.  TLTRFFAIHFLLPFIIAGLTLVHLTLLHETGSNNPLGIPSDCDKIPFHPYYSTKDILGFA
Babbler         TLTRFFALHFLLPFVFAGLTLVHLTFLHETGSNKPLGIPSDCDKIPFHPYYSTKDVLGFV 
Rufous babbler  TLTRFFALHFLLPFVIAGLTLVHLTFLHETGSNNPLGIPSDCDKIPFHPYYSTKDVLGFA 
Thrush          TLTRFFALHFLLPFVIAGLTLVHLTFLHETGSNNPLGIPADCDKIPFHPYYSTKDILGFA 
Bowerbird       TLTRFFALHFLLPFVIAGITLVHLTFLHETGSNNPLGIPSDCDKIPFHPYYSMKDILGFA 
Sicklebill      TLTRFFALHFLLPFVITGLTLVHLTFLHETGSNNPLGIPSDCDKIPFHPYYSIKDILGFA 
Magpie          TLTRFFALHFLLLFVTVGLTLVHLTFLHETGSNNPLGIPSDCDKIPFHPYYSIKDMLGFA 
Honeyeater      TLTRFFALHFLLPFAITGLTLVHLTFLHETGSNNPLGIPSDCDKIPFHPYYSMKDILGFA 
Titmouse        TLTRFFALHFLLPFVIAGLTLVHLTFLHETGSNNPLGIPSDCDKIPFHPYYSTKDILGFA 
Tapaculo        TLTRFFALHFLLPFIITGLTLVHLTFLHETGSNNPLGIPSECDKIPFHPYFSIKDILGFM 
Canastero       MLTRFFALHFLLPFMIAGLTFIHLTFLHETGSNNPLGISSNCDKIPFHPYFSTKDILGFL 
Cotinga         TLTRFFALHFLLHFIIAGLTFIHLTLLHETGSNNPLGISSNCDKIPFHPYFSTKDALGFI 
Pitta           TLTRFFALHFLLPFIIASLTLIHLTFLHETGSNNPLGVQSNCDKIPFHPYLSSKDILGFM 
Flicker         TLTRFFALHFLLPFLIAGLTLIHFTFLHESGSNNPLGIMSDCDKIPFHPYFSVKDILGFM 
Toad, african   TLTRFFAFHFLLPFIIAGASILHLLFLHETGSTNPTGLNSDPDKVPFHPYFSYKDLLGFL 
Cod             TLTRFFAFHFLFPFVVAAFTMLHLLFLHETGSNNPTGINSNADKIPFHPYFTYKDLLGFA 
Eel             TLTRFFAFHFLFPFVVAALTMLHLLFLHETGSNNPVGLNSDADKIPFHPYFSYKDLLGFI 
Lythrurus       TLTRFFAFHFLFPFVIAGATVLHLLFLHETGSNNPAGLNSDADKISFHPYFSYKDLLGFV 
Carp            TLTRFFAFHFLLPFVIAAATIIHLLFLHETGSNNPIGLNSDADKVSFHPYFSYKDLLGFV 
Loach           TLTRFFAFHFLFPFIVAAVTILHLLFLHETGSNNPAGLNSDADKISFHPYFSYKDLLGFV 
Astronotus      TLTRFFAFHFLFPFVIAAMTMIHLIFLHETGSTNPTGLNSDADKISFHPYFSYKDLLG-- 
Cichlasoma citr.TLTRLFAFHFLLPFIIAAITM--------------------------------------- 
Cichlasoma spil.TLTRLFAFHFLLPFIIAAITMIHLIFLHETGSTNPAGLNSDTDKILFHPYFLYKDLLGFA 
Hemichromis     TLTRLFAFHFLLPFIIAAATMVHLIFLHETGSNNPAGLNSDADKISFHPYFPIKD----- 
Tilapia         TLTRFFAFHFLLPFIIAAATMVHLIFLHETGSNNPTGLNSDADKISFHPYFSYKDLLGFA 
Trachurus       TLTRFFAFHFLLPFVIAAFFVLHVLFLHETGSNNPTGLNSDADKISFHPYFSYKDLLGFA 
Bass            TLTRFFAFHFLFPFVIAGATMLHLLFLHQTGSNNPLGLNSDVDKISFHPYFSYKDLLGFA 
Mackerel        TLTRFFAFHFLFPFVILAAAVLHLLFLHETGSNNPIGLNSNADKISFHPYFTYKDLLGFA 
Bogue           TLTRFFAFHFLLPFVVAAMTMLHLLFLHETGSNNPIGLNSDTDKISFHPYFSYKDLLGFA 
Sard            TLTRFFAFHFLFPFVILAMTILHLLFLHETGSNNPIGLNSNADKISFHPYFSYKDLLGFA 
Tuna            TLTRFFAFHFLFPFVIAAMTILHLLFLHETGSNNPIGLNSNADKISFHPYFSYKDLLGFV 
Blue marlin     TLTRFFAFHFLLPFIIAAMTVIHLLFLHETGSNNPTGLNSDADKISFHPYFSYKDLLGFA 
Swordfish       TLTRFFAFHFLLPFVIMAATIIHLLFLHETGSNNPTGLNSDADKISFHPYFSYKDLLGFA 
Sturgeon, white TLTRFFAFHFLLPFVIAGASMIHLLFLHQTGSNNPTGLNSDADKVTFHPYFSYKDLFGFT 
Shark 1         TLTRFFAFHFLLPFLILALTIIHLLFLHETGSNNPLGINSDADKISFHPYFSYKDLLGFF 
                     180       190       200       210        220      230   
Isurus shark    TLTRFFAFHFLLPFLITALMIIHVLFLHETGSNNPMGLNSDMDKISFHPYFSYKDALGFF 
Sea urchin1     TLTRFFPFHFLFPFIIAALAVIHLVFLHNSGANNPFAFNSNYDKAPFHIYFTTKDTVGFI 
Sea urchin2     TLTRFFAFHFLFPFIIAALAIIHLVFLHNSGANNPVGLNSNYDKAPFHIYYTTKDTVGFI 
Fly 1           TLTRFFTFHFILPFIVLAMTMIHLLFLHQTGSNNPIGLNSNIDKIPFHPYFTFKDIVGFI 
Anopheles       TLTRFFTFHFIFPFIILALMMIHLLFLHQTGSNNPLGLNSNVDKIPFHPYFIYKDIFGFI 
Ant             TLNRFYSLHFILPFLISFMVILHLIFLHDTGSSNPLGTNSDMNKIPFHYYFTIKDILGFT 
Honeybee        TLNRFFSLHFILPLLILFMVILHLFALHLTGSSNPLGSNPNNYKISFHPYFSIKDLLGFY 
Shrimp 1        TLTRFFTFHFLIPFLVAGLTMIHLLFLHQSGSNNPLGINANLDKLPFHPYFTIKDTVGFM 
Blue mussel     TLKRFYTLHFLLPFCNSGG----------------------------------------- 
Worm, free      TLKFFFVLHFLLPWAILVIVLGHLIFLHSTGSTSSLYCHGDYDKVCFSPEYLGKDAYNIV 
Worm, round     TLKFFFVLHFLVPWGLLLLVLLHLVFLHETGSTSKLYCHGDYDKVCFYPEYWVKDFLNVV 
                ==      ==            =   ==  =               =      ==      
Yeast           TIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVF 
                              D        *                          ** * *E*   


                     240       250       260       270       280       290   
Man             LFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLA 
Seal            LLILVLTLLVLFSPDLLGDPDNYIPPNPLSTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Beef            LLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Sheep           MLILILMLLVLFTPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Deer, black tai.LLTLFLMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Giraffe         LLILVLMLLVLFTPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Rat 2           MLLLFLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVVA 
Mouse           IMFLILMTLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Dolphin1        LLILTLLALTLFTPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Dolphin2        FLILTLLALTLFAPDLLGDPDNYTPANPLSTPAHIK------------------------ 
Camel           LLMLALLILVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Pig             FMMLILLILVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Rabbit          VAILLLLILVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Zebra           LLILLLLTLVLFSPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Rhinocerus      LLILTLLTLVLFSPHHLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLA 
Elephant        LLILLLLLLALLSPDHLGDPDNYTLANPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLA 
Chicken         LMLTPFLTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Turkey          IMLTPLLTLTLFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Guinea-fowl     LMLTPLLTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Blue tit        LMLIILVSLALFSPNLLGDPENFTPANP-------------------------------- 
Blackcap        LMFIPLAALALFSPNLLGDPENFTPANPLATPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Warbler magni.  FMFIPLTSLALFSPNLLGDPENFTPANPLATPPHIKPEWYFLFAYAILRSIPNKLGGVLA
Babbler         LMLIPLITLALFSPNLLGDPENFTPANPLATPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Rufous babbler  LLLTPLIALALFSPNLLGDPENFTPANPLATPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Thrush          LMLILLISLALFPPNMLGDPENFTPANPLATPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Bowerbird       LLFIALVAMALFSPNLLGDPENFTPANPLSTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Sicklebill      LMLITLATLALFSPNLLGDPENFTPANPLATPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Magpie          LMLILLATMALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Honeyeater      LMIIPLAALALFSPNLLGDPENFTPANPLATPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Titmouse        LMFILLVSLALFSPNSLGDPENFTPANPLSTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Tapaculo        AMLLPLMSLAMFSPNLLGDPENFTPANPLVTPLHIKPEWYFLFAYAILRSIPNKLGGVLA 
Canastero       AMLVPLTALAMFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Cotinga         LLLFPLMTLAMFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Pitta           IMLLPLMTLAMFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFACAILRSIPNKLGGVLA 
Flicker         FMLLPLTTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Toad, african   IMLTALTLLAMFSPNLLGDPDNFTPANPLITPPHIKPEWYFLFAYAILRSM-NKLGGVLA 
Cod             VMLLGLTALALFAPNLLGDPDNFTPANPIVTPPHVKPEWYFLFAYAILRSIPNKLGGVLA 
Eel             IML--------------------------------------------------------- 
Lythrurus       LMLLALTSLTSFSPTLLGDPENFTPANPLVTPPHIQPEWYFLFAYAILRSIPNKLGGVLA 
Carp            IMLLALTLLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Loach           VMLLGLTTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Cichlasoma spil.ILLIALIALAS------------------------------------------------- 
Tilapia         ILLIALISLALFSPNLLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Tracurus        ALLTALASLALFSPNLLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Bass            IVLIGLTSLALFSPNLLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Mackerel        VLLMGLTSLALFSPNLLGDPDNFTPANPMVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Bougue          GVIILLTCLALFAPNLLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Sard            ILLVALASLALFSPNLLGDPDNFTPANPMVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Tuna            ILLVALASLALFSPNLLGDPDNFTPANPMVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Blue marlin     ALLIGLTSLALFSPN--------------------------------------------- 
Swordfish       ALLVALTSLALFSPN--------------------------------------------- 
Sturgeon, white LMLVGLTSVALFSPNLLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Shark 1         VMIFFLAVFALFMPNLLGDAENFIPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Isurus shark    TLLILLGVLALFLPNLLGDAENFIPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLA 
Sea urchin1     LLVAALFSLALLFPGALNDPENFIPANPLVTPPHIQPEWYFLFAYAILRSIPNKLGGVIA 
Sea urchin2     ALIAALFVLALLFPCALNDPENFIPANPLCTPPHIQPEWYFLFAYAILRSIPNKLGGVIA 
Sea star        -----------LSPTLLNDPENFNPANPLVTPLHIQPEWYFLFAYAILRSIPNKLGGVLA 
Fly 1           VMIFILISLVLISPNLLGDPDNFIPANPLVTPAHIQPEWYFLFAYAILRSIPNKLGGVIA 
Anopheles       VFYWILIRFIWKFNYLLMDPENFIPANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVIA 
                     240       250       260       270       280       290   
Ant             IIMIIFMIVILQYPYVFSDPDNFTMANPMVTPIHIQPEWYFLFAYAILRSIPNKLGGVLA 
Honeybee        IILFIFMFINFQFPYHLGDPDNFKIANPMNTPTMIKPEWYFLFAYSILRAIPNKLGGVIG 
Shrimp 1        VLIFFLVTLSLTSPYLLGDPDNFIPANPLVTPAHIQPEWYFLFAYAILRSIPNKLGGVIA 
Worm, free      IWLLFIVLSLIY-PFNLGDAEMFIEADPMMSPVHIVPEWYFLFAYAILRAIPNKVLGVIA 
Worm, round     VWFVFIFFSLGY-PFLLGDPEMFIESDPMMSPVHIVPEWYFLFAYAILRAIPNKVLGVVS 
                                  =        =        ========  ===    =  ==   
Yeast           LFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVIT 
                    E                #                  #          ====F=#==


                     300       310       320        330       340       350  
Man             LLLSILILAMIPILHMSKQQSMMFRPLSQSLY-WLLAADLLILTWIGGQPVSYPFTIIGQ 
Seal            LVLSILVLAIMPLLHTSKQRGMMFRPISQCLF-WFLVADLLTLTWIGGQPVEHPYITVGQ 
Beef            LAFSILILALIPLLHTSKQRSMMFRPLSQCLF-WALVADLLTLTWIGGQPVEHPYITIGQ 
Sheep           LVLSILVLVIMPLLHTSKQRSMMFRPISQCLF-WILVADLLTLTWIGGQPVEHPYIIIGQ 
Deer, black tai.LVLSILILVLMPLLHTSKQRSMMFRPFSQCLF-WILVAHLLTLTWIGGQPVEHPFIIIGQ 
Giraffe         LVLSILILIFMPLLHTSKQRSMMFRPFSQCLF-WILVADLLTLTWIGGQPVEHPFIIIGQ 
Rat 2           LILSILILAFLPFLHTSKQRSLTFRPITQILY-WILVANLLVLTWIGGQPVEHPFIIIGQ 
Mouse           LILSILILALMPFLHTSKQRSLMFRPITQILY-WILVANLLILTWIGGQPVEHPFIIIGQ 
Dolphin1        LLLSILILIFIPMLHTSKQRSMMFRPFSQLLF-WVLIADLLTLTWIGGQPVEHPYIIVGQ 
Camel           LVLSILILAFIPALHTSKQRSMTFRPISQCLF-WVLVADLLTLTWIGGQPVEPPFIMIGQ 
Pig             LVASILILILMPMLHTSKQRGMMFRPLSQCLF-WMLVADLITLTWIGGQPVEHPFIIIGQ 
Rabbit          LVLSILVLAFIPFLHMSKQRSMMFRPISQVLF-WVLVADLLTLTWIGGQPVEHPFITIGQ 
Zebra           LILSILILALIPTLHTSKQRSMMFRPLSQCVF-WLLVADLLTLTWIGGQPVEHPYMIIGQ 
Rhinocerus      LALSILILALIPILHTSKQRSMMFRPLSQCMF-WLLVADLLTLTWIGGQPVEHPFIIIGQ 
Elephant        LLLSILILGLMPLLHTSKHRSMMLRPLSLCAYCWTLTMDLLTLTWIGSQPVEYPYIIIGQ 
Chicken         LAASVLILFLIPFLHKSKQRTMTFRPLSQTLF-WLLVANLLILTWIGSQPVEHPFIIIGQ 
Turkey          LAASVLILLLIPFLHKSKQRAMTFRPLSQTLF-WLLVANLLILTWVGSQPVEHPFIIIGQ 
Guinea-fowl     LAASVLILLLIPFLHKSKQRTMTFRPFSQLLF-WLLVANLLILTWVGSQPVEHPFIIIGQ 
Blue tit        ----------------SKQRSMTFRPLSQVLF-WTLVANLLILTWVGSQPVEHPFIIIGQ 
Blackcap        LAASVLVLFLMPLLHTSKLRSMTFRPLSQILF-WTLVANLLIL----------------- 
Warbler magni.  LAASVLVLFLVPLLHTSKLRSMTFRPLSQILF-WALVANLLIL----------------- 
Babbler         LAASVLVLFLIPLLHTSKLRSMTFRPLSQILF-WTLVANLLMLTWVGS------------ 
Rufous babbler  LAASVLVLFLIPLLHNSKLRSMTFRPLSQILF-WALVANLLVLTWVGS------------ 
Thrush          LAASVLVLFLFPLLHKSKQRSMTFRPLSQILF-WTLVANLLVLTWVGS------------ 
Bowerbird       LAASVLVLFLIPLLHTSKQRSMTFRPLSQILF-WTLVANLLVLTWVGS------------ 
Sicklebill      LAASVLILFLIPLLHTSKQRSMTFRPLSQILF-WILVTNLLILTWVGS------------ 
Magpie          LAASVLVLFLVPLLHKSKQRSMTFRPLLPFLF-WTLVANLLILTWVGS------------ 
Honeyeater      LAASILVLFLIPLLHKSKQRSMTFRPLSQILF-WTLVANLLILTWVGS------------ 
Titmouse        LAASVLVLFLLPLLHTSKQRSMTFRPLSQILF-WALVANLLILTWVGS------------ 
Tapaculo        LAASVLILFLIPLLHKSKQRTMTFRPLSQLMF-WILVANLLILTWVGS------------ 
Canastero       LAASVLILFLIPLLHKSKQRTMTFRPLSQLLF-WILVTNLLILTWVGS------------ 
Cotinga         LAASVLILLLIPLLHTSKQRTMTFRPLSQFLF-WTLVMNLLILTWIGS------------ 
Pitta           LAASVLILFLIPLLHKSKQRTMTFRPLSQLLY-WTLVANLLILTWVGS------------ 
Flicker         LAASVLVLFLAPLLHTSKQRTMAFRPLSQFLF-WMLVANLLILTWVGS------------ 
Toad, african   LVLSILILALMPLLHTSKQRSLMFRPFTQIMF-WALVADTLILTWIGGQPVEDPYTMIGQ 
Cod             LLFSILVLMVVPFLHTSKQRGLTFRPLTQMLF-WVLVADMLVLTWIGGVPVEHPFIIIGQ 
Lytrurus        LLFTILVLLVVPILHTSKQRGLTFRPITQFLF-WTLVADMIILTWIGGMPVEHPYIIIGQ 
Carp            LLFSILVLMVVPLLHTSKQRGLTFRPITQFLF-WTLVADMIILTWIGGMPVEHPFIIIGQ 
Loach           LLFSILVLMVVPVLHTSKQRGLTFRPATQFLF-WTLVADMIILTWIGGMPVEHPYIIIGQ 
Astronotus      ----------------------------PNLF-WLLVAKVAILTWIGGMPVEHPFIIIGQ 
Tilapia         LLFSILVLMVVPILHTSKQRGLTFRPITQFLF-WLLVADVAILTWIGGMPVEHPFVIIGQ 
Trachurus       LLFSILVLMVVPILHTSKQRGLTFRPITQFLF-WTLVADVAILTWIGGMPVEHPFVIIGQ 
Bass            LLASILVLMVVPYLHTSKQRSMTFRPVTQFLF-WALVADVMILTWIGGMPVEHPFIIIGQ 
Mackerel        LLASILILMVVPFLHTSKQRALTFRPASQFLF-WTLVADVVVLTWIGGMPAEQPFIIIGQ 
Bogue           LLASILVLMVVPLLHTSKQRSLTFRPVTQFLF-WALIANVAILTWIGGMPVEEPYIIIGQ 
Sard            LLASILVLMVVPFLHTSKQRTLTFRPVSQFLF-WTLIADVAILTWIGGMPAEQPFIIIGQ 
Tuna            LLASILVLMVVPFLHTSKQRTLTFRPVSQFLF-WTLIADVAILTWIGGMPAEQPFIIIGQ 
Sturgeon, white LLFSILVLMLVPMLHTSKQRGNTFRPLSQILF-WALVADMLVLTWIGGQPVEHPFVLIGQ 
Shark 1         LLFSIFILMLVPLLHTSKQRSTIFRPMTQIFF-WLLVANSIILTWIGGQPVEQPFIMVGQ 
Isurus shark    LLFSILILMLVPFLHTSKQRSSIFRPLTQIFF-WTLVANMLILTWIGGQPVEQPFILIGQ 
Sea urchin1     LVAAILVLFLMPLLNTSKNESNSFRPLSQAAF-WLLVAHLFILTWIGSQPVEYPYVLLGQ 
Sea urchin2     LVAAILVLFLMPLLNTSKNESNSFRPLSQATF-WILVATFFVLTWIGSQPVEQPFVLIGQ 
Sea star        LLASILVLFLVPILHTSNNQANTFRPASQSFF-WYLIGVFIILTWIGSQPVEEPFIILGQ 
Fly 1           LVLSIAILMILPFYNLSKFRGIQFYPINQILF-WSMLVTVILLTWIGARPVEEPYVLIGQ 
Anopheles       LVLSIAILLILPFTHSSKFRGLQFYPLNQILF-WNMVVVASLLTWIGARPVEDPYVLTGQ 
Ant             LVSSIFILYFLPLNKM--EMNTNFYPTNQINF-WLLMNSFIILTWVGAQSIEDPFVLISQ 
Honeybee        LVMSILILYIMIFYNN-KMMNNKFNMLNKIYY-WMFINNFILLTWLGKQLIEYPFTNINM 
Shrimp 1        LVSSILILVSLPFTFKPKFRGLEFYSVAQPLF-WSWVSVFLLLTWIGARPVEDPYNFLGQ 
Blue mussel     ------------------------YPLNQVVF-WVLVGSFISLTWIGARPVREPYIILGS 
                     300       310       320        330       340       350  
Worm, free      LLMSIVTFYFFALVNNYT--SCL-TKLNKFLV-FMFIISSTILSWLGQCTVEDPFTILSP 
Worm, round     LFASILVLVVFVLVNNYV--SVM-SKLNKFLV-FVFIFVLVVLSWLGQCLVEDPFVFLSM 
                =                                         = =        =       
Yeast           MFAAILVLLVLPFTDRSVVRGNTFKVLSKFFF-FIFVFNFVLLGQIGACHVEVPYVLMGQ 
                #-  F                              G                      == 


                      360       370       380                                
Man             VASVLYFTTILILMPTISLIENKMLKWA-------------------------------- 
Seal            LASILYFTILLVLMPIASIIENNILKW--------------------------------- 
Beef            LASVLYFLLILVLMPTAGTIENKLLKW--------------------------------- 
Sheep           LASIMYFLIILVMMPVASIIENNLLKW--------------------------------- 
Deer, black tai.LASILYFLIILVLMPVTSTIENNLLKW--------------------------------- 
Giraffe         LASIMYFLIILVLMPVTSAIQNNLLKW--------------------------------- 
Rat 2           LASISYFSIILILMPISGIVEDKMLKWN-------------------------------- 
Mouse           LASISYFSIILILMPISGIIEDKMLKLILYP----------------------------- 
Dolphin1        LASILYFLLILVLMPTAGLIENKLLKW--------------------------------- 
Dolphin2        ---------ILVLMPTVSLIENKLLKW--------------------------------- 
Camel           VASILYFSLILILMPVAGIIENRILKW--------------------------------- 
Pig             LASILYFLIILVLMPITSIIENNLLKW--------------------------------- 
Rabbit          VASVLYFTTILILMPLASLIENKILKW--------------------------------- 
Zebra           LASILYFSLILIFMPLASTIENNLLKW--------------------------------- 
Rhinocerus      LASILYFSLILVLMPLAGIIENNLLK---------------------------------- 
Elephant        MASILYFSIILAFLPIAGVIENYLIK---------------------------------- 
Chicken         MASLSYFTILLILFPTIGTLENKMLNY--------------------------------- 
Turkey          MASLSYFTILLILFPLIGALENLMLNL--------------------------------- 
Guinea-fowl     LASLSYFTTLLILFPMIGTLENKMLNH--------------------------------- 
Blue tit        LASLSYFTIILVLFPLAAILENKILKL--------------------------------- 
Toad, african   LASVIYFSIFIIMFPLMGWVENKLLNW--------------------------------- 
Cod             VASVLYFSLFLVLFPLAGWTENKALEWN-------------------------------- 
Lythrurus       VASVLYFALFLLLAPLAGWAENKALKW--------------------------------- 
Carp            IASVLYFALFLIFMPLAGWLENKALKWACPRSLA-------------------------- 
Loach           IASILYFALFLILIPLAGWLENKALEWV-------------------------------- 
Astronotus      IASFLYFFIFLILVPTIGLLENKI------------------------------------ 
Tilapia         IASFLYFFLFLILAPITGWLENKILEWHCTSSSA-------------------------- 
Trachurus       VASVLYFLLFLVFLPLAGWVENKMLGWACTSSSA-------------------------- 
Bass            VASLLYFLLFLVFIPVVGELENKALEWLCISSSV-------------------------- 
Mackerel        VASVLYFSLFLVLFPLAGWAENKVLGWTCISSSA-------------------------- 
Bogue           IASLTYFSLFLLIIPMAATLENKVLGWQCTSSSA-------------------------- 
Sard            VASVLYFSLFLVFFPLAGWAENKILGWSCISSSA-------------------------- 
Tuna            VASVLYFSLFLVFFPLAGWAENKILGWSCTSSSA-------------------------- 
Sturgeon, white VASTVYFALFLIALPLTGWLENKALNWN-------------------------------- 
Shark 1         IASISYFSLFLIIMPLTSWWENKILSLN-------------------------------- 
Isurus shark    IASISYFSLFLIALPLAGWWENKILNLN-------------------------------- 
Sea urchin1     VASVLYFSLFIFGFPIVSSIENKIIFS--------------------------------- 
Sea urchin2     IASLLYFSLFIFGFPLVSSLENKMIFS--------------------------------- 
Sea star        ISSILYFMLFILFIPITAQIENNLIF---------------------------------- 
Fly 1           ILTIIYFLYYLI-NPLVTKWWDNLLN---------------------------------- 
Anopheles       ILTVLYFSYFII-NPLLAKYWDKLLN---------------------------------- 
Ant             ITALIYFSTLSL-ISISGSLWNKMINL--------------------------------- 
Honeybee        LFTTTYFLYFFL-NFYLSKLWDNLIWNSPLN----------------------------- 
Shrimp 1        ILTCAYFSYFVF-TPIVINLNDKIV----------------------------------- 
Blue mussel     AFQLFISLVYCW-TPFLYGCEMNYLNTLNFV----------------------------- 
Worm, free      LFSFIYFGLAYLMLFIFMSSKLLFK----------------------------------- 
Worm, round     VFSFLYFFVIFLLFLVYYFAGRVFM----------------------------------- 
                                                        
Yeast           IATFIYFAYFLIIVPVISTIENVLFYIGRVNK---------------------------- 
                         H